CN-119950678-B - Application of antibacterial peptide CHICKEN CATH-3 synergistic antibiotic in resisting drug-resistant pseudomonas aeruginosa infection

Abstract

The invention belongs to the technical field of biological medicines, and discloses application of an antibacterial peptide CHICKEN CATH-3 synergistic antibiotic in resisting drug-resistant pseudomonas aeruginosa infection. According to the invention, through a chessboard minimum inhibition concentration test, an in vitro time-sterilization curve test verifies that the antibacterial peptide CHICKEN CATH-3 and CTX combined drug administration has obvious synergistic effect on resisting drug-resistant pseudomonas aeruginosa, and the antibacterial peptide CHICKEN CATH-3 can remarkably improve the sterilization capability of CTX antibiotics on multiple drug-resistant pseudomonas aeruginosa strains. The invention provides a novel combined medication strategy and provides a novel research thought and direction for solving the drug resistance problem of pseudomonas aeruginosa which is serious day by day.

Inventors

• FANG LIANGXING
• SU YUTING
• CHEN SHUYI
• HE YUZHANG
• CHEN JIAXI

Assignees

• 华南农业大学

Dates

Publication Date

20260508

Application Date

20250217

Claims (3)

1. 1. The application of the antibacterial composition in preparing medicines for resisting multiple drug-resistant pseudomonas aeruginosa infection is characterized in that the composition comprises antibacterial peptide CHICKEN CATH-3 and cefotaxime, the amino acid sequence of the antibacterial peptide CHICKEN CATH-3 is shown as SEQ ID NO. 1, the multiple drug-resistant pseudomonas aeruginosa strain is DYE7, DYC7, DS-C41-1, DS-C44-1, JMA210 or JMA36, the concentration of the antibacterial peptide CHICKEN CATH-3 in the composition is 0.5-4 mug/mL, and the concentration of cefotaxime is 1-32 mug/mL.
2. 2. The use according to claim 1, wherein the medicament comprises antibacterial peptide CHICKEN CATH-3, cefotaxime, and pharmaceutically acceptable carriers and excipients.
3. 3. The use according to claim 1, wherein the pharmaceutical dosage form is selected from any one of a capsule, a slow-release or controlled-release tablet, an oral liquid dosage form, an injection dosage form, a lyophilized powder for injection, and a cream.

Description

Application of antibacterial peptide CHICKEN CATH-3 synergistic antibiotic in resisting drug-resistant pseudomonas aeruginosa infection Technical Field The invention belongs to the technical field of biological medicines, and particularly relates to application of antibacterial peptide CHICKEN CATH-3 synergistic antibiotics in resisting drug-resistant pseudomonas aeruginosa infection. Background Pseudomonas aeruginosa is a pathogenic bacterium capable of infecting various animals and causing various serious diseases, and resistance to antibiotics has been becoming serious in recent years. The strain not only can form a biological film and increase treatment difficulty, but also brings great challenges to clinical treatment, and becomes a great problem threatening global public health safety. In view of the severe situation of pseudomonas aeruginosa resistance, development of novel antibacterial drug combinations and therapeutic regimens against this pathogen has been urgent. Antibiotics are a class of chemicals produced by microorganisms that can inhibit or kill other microorganisms at low concentrations and have found great utility in the human health industry. They are not only used for preventing and treating infectious diseases in animals, but also exhibit antitumor, antiviral, insecticidal and herbicidal functions in agriculture. However, with the massive use of antibiotics in disease control, especially for non-scientific, unreasonable abuse, bacterial resistance and drug residue problems are increasingly prominent. The antibacterial peptide, which is a natural small molecular polypeptide encoded by organism genes, is a key molecule in the immune system of organisms and shows the direct killing effect on bacteria, fungi, viruses, even protozoa and tumor cells. Compared with the traditional antibiotic treatment, the antibacterial peptide (AMPs) has multiple remarkable advantages that the antibacterial peptide (AMPs) can resist various pathogenic bacteria simultaneously, can kill microorganisms directly or indirectly through activating an immune system, has the functions of resisting inflammation, promoting wound healing and the like, and has high-efficiency sterilization. Of particular importance, AMPs generally induce lower transient resistance than traditional antibiotics. The antibiotic and the antibacterial peptide are further combined for use, so that the treatment effect can be effectively improved. Namely, two or more antibiotics are simultaneously or sequentially applied to treat related diseases caused by microbial infection, and the preparation method has the advantages of enhancing the curative effect of the medicine, relieving the toxic and side effects of the medicine and the like. At present, the application of the antibacterial peptide CHICKEN CATH-3 combined with antibiotics to resisting the drug-resistant pseudomonas aeruginosa infection has not been reported. Disclosure of Invention In order to solve the defects in the prior art, the invention provides a method for enhancing the antibacterial activity of antibiotics, which adopts a combination of natural antibacterial peptide CHICKEN CATH-3 derived from chickens and the antibiotic CTX (cefotaxime), and the two are simply added in function, so that the synergistic antibacterial effect is achieved. The invention also discloses an antibacterial combination of the antibacterial peptide CHICKEN CATH-3 and the antibiotic CTX, and provides a new treatment strategy for clinically treating drug-resistant pseudomonas aeruginosa infection, in particular to multi-drug-resistant pseudomonas aeruginosa infection. In order to achieve the above purpose, the present invention provides the following technical solutions: the first aspect of the invention is to provide an application of the antibacterial peptide CHICKEN CATH-3 combined with cefotaxime in preparing medicines for resisting drug-resistant pseudomonas aeruginosa. The amino acid sequence of the antibacterial peptide CHICKEN CATH-3 is shown as SEQ ID NO.1, and is specifically RVKRFWPLVPVAINTVAAGINLYKAIRRK. Preferably, the drug resistant pseudomonas aeruginosa is a multi-drug resistant pseudomonas aeruginosa. More preferably, the multidrug resistance is 3 or more antibiotics or antibacterial agents such as penicillins, fosfomycin, penems, aminoglycosides, β -lactams, quinolones, tetracyclines, cephalosporins, glycylcyclines, and macrolides. More preferably, the multiple drug resistance is any three or more of antibiotics such as FOS, KAN, AMP, FFC, TET, CTX, TIG, CS, MEM, CIP resistance. In some particularly preferred embodiments of the invention, the standard Pseudomonas aeruginosa strain is ATCC 27853 and the multi-drug resistant Pseudomonas aeruginosa strain includes DYE7 (resistant to antibiotics such as FOS, KAN, AMP, FFC), DYC7 (resistant to antibiotics such as TET, KAN, AMP, FFC), DS-C41-1 (resistant to antibiotics such as FOS, CTX, TIG, CS), DS-C44-1 (resistant to antibiotics such as FO