CN-121975742-A - Tropical panonychus ulmi allergen 37 th component monoclonal antibody, hybridoma cell strain and application thereof

Abstract

The invention relates to a 37 th component monoclonal antibody of a Tropical panonychus ulmi allergen, a hybridoma cell strain and application thereof, and belongs to the technical field of immunodetection. The hybridoma cell strain secreting the 37 th component monoclonal antibody of the Trolley mite allergen is obtained by first screening, and the monoclonal antibody secreted by the hybridoma cell strain has good sensitivity to Blo t 37, and EC 50 is 27.56 ng/mL, so that low-concentration Blo t 37 can be accurately detected. The monoclonal antibody provided by the invention is applied to Blo t 37 detection products, and can realize high-efficiency detection of low-concentration Blo t 37.

Inventors

• CUI YUBAO
• MA XIMENG
• ZHOU YING

Assignees

• 无锡市人民医院

Dates

Publication Date

20260505

Application Date

20260121

Claims (10)

1. 1. The hybridoma cell strain is characterized in that the preservation number of the hybridoma cell is CCTCC No. C2025372.
2. 2. The hybridoma cell line according to claim 1, wherein said hybridoma cell line is obtained by immunizing an animal with a complete antigen, wherein said complete antigen is the 37 th component of the panonychus tropicalis allergen.
3. 3. The hybridoma cell line according to claim 2, wherein the amino acid sequence of said complete antigen is shown in SEQ ID No. 1.
4. 4. Use of a hybridoma cell line according to any one of claims 1-3 for the detection of component 37 of the Tropical panonychus scale allergen.
5. 5. A monoclonal antibody secreted by the hybridoma cell line of any one of claims 1-3.
6. 6. Use of the monoclonal antibody of claim 5 for detecting component 37 of the Tropical panonychus allergen.
7. 7. A test product of component 37 of a panonychus tropicalis allergen, comprising the monoclonal antibody of claim 5.
8. 8. The test product of claim 7, wherein the monoclonal antibody is labeled with colloidal gold.
9. 9. The detection product according to claim 8, wherein the detection product comprises a box body and a reagent strip placed in the box body, wherein the reagent strip comprises a bottom plate, and a sample pad, a binding pad, a nitrocellulose membrane and a water absorption pad which are sequentially overlapped end to end along the length direction of the bottom plate, and the binding pad is coated with a monoclonal antibody marked by colloidal gold.
10. 10. The test product of claim 9, wherein the nitrocellulose membrane comprises a detection zone and a quality control zone, wherein the detection zone comprises a capture antibody that specifically binds to the colloidal gold-labeled monoclonal antibody, and wherein the quality control zone comprises goat anti-mouse immunoglobulin IgG.

Description

Tropical panonychus ulmi allergen 37 th component monoclonal antibody, hybridoma cell strain and application thereof Technical Field The invention relates to the technical field of immunodetection, in particular to a 37 th component monoclonal antibody of a Tropical panonychus ulmi allergen, a hybridoma cell strain and application thereof. Background A single component allergen is a single protein or recombinant expression product thereof isolated from a natural allergen, having a defined structure and a defined function, and capable of binding to specific IgE antibodies in a patient. Component-resolved diagnosis (CRD) techniques based on Component allergens can effectively avoid interference of non-sensitized components in crude extracts, reduce risk of misdiagnosis, and facilitate clinical differentiation of cross-reactivity (Cross-reactivity) from co-sensitization (co-sensitization), thereby reducing unnecessary treatment. Allergen-specific immunotherapy (AIT) is currently the only therapeutic approach that can interfere with allergic diseases from an etiology level. In the AIT process, specific sensitization components of the patient are clarified to not only help reduce the occurrence of side effects, but also improve patient compliance. Therefore, the research and clinical popularization and application of the component allergen are of great significance for promoting the individuation and accurate diagnosis and treatment of allergic diseases. Tropical panonychus ulmi (Blomia tropicalis) is one of the indoor dust mites that are widely distributed worldwide, particularly in tropical and subtropical areas. It often coexist with house dust mites in the home environment and becomes a main causative factor for inducing allergic diseases such as asthma, allergic rhinitis, atopic dermatitis and the like. However, as global climate warms, the growth range of Tropical panonychus ulmi has gradually expanded to temperate regions. In China, especially in southern and coastal areas, the detection rate of the Tropical panonychus ulmi is high. For example, research shows that in areas such as Hainan and Fujian, the detection rate of Tropical claw-free mites in bed dust can reach more than 70%. In addition, epidemiological investigation confirmed that Tropical panonychus ulmi is the third largest allergen following house dust mites and is an important sensitized mite species. In the children population of Malaysia, singapore, taiwan, guangdong, etc., the sensitization rate of Tropical panonychus ulmi is generally up to 50% or even more. From 2008 to 2018, the overall sensitization rate of asthma and/or rhinitis patients in China to Tropical panonychus ulmi is increased from 24.0% to 30.7%, and a clear rising situation is shown. In previous studies a new Trolley et al allergen Blo t 37 has been found, however, there is still a lack of monoclonal antibodies in the prior art for detecting this allergen. Disclosure of Invention Therefore, the technical problem to be solved by the invention is to overcome the defect that a monoclonal antibody for detecting allergen Blo t 37 is lacking in the prior art. In order to solve the technical problems, the invention provides the 37 th component monoclonal antibody of the Tropical panonychus ulmi allergen, the hybridoma cell strain and the application thereof, and the hybridoma cell strain secreting the 37 th component monoclonal antibody of the Tropical panonychus ulmi allergen is obtained by first screening, and the monoclonal antibody secreted by the hybridoma cell strain has good sensitivity to Blot 37, and EC 50 is 27.56 ng/mL, so that low-concentration Blot 37 can be accurately detected. The monoclonal antibody provided by the invention is applied to Blo t 37 detection products, and can realize high-efficiency detection of low-concentration Blo t 37. The first object of the invention is to provide a hybridoma cell strain, wherein the preservation number of the hybridoma cell is CCTCC No. C2025372. Further, the hybridoma cell line is obtained by immunizing an animal with a complete antigen, wherein the complete antigen is the 37 th component of the Tropical panonychus ulmi allergen. Further, the amino acid sequence of the complete antigen is shown as SEQ ID NO. 1. Further, SEQ ID No.1: MARVFIIAFALIGSVLADELCHSKPDGTLVPDPKSKTDFYECNNGMAFKLHCPTGLIFEEAAHGCVNDPNRPTEKIPCLSDSKFDCTGKPDGFYIDSDDRTKFHECDHHCPYDFHCPPLTYFEPSKNVCVFDKDNHEHTTMKPEVTTHAHEETTSSNVPTEITTPFQPTTEILSTESTHSSNDQTTRGRH. The second object of the invention is to provide an application of the hybridoma cell strain in detecting the 37 th component of the Tropical panonychus ulmi allergen. A third object of the present invention is to provide a monoclonal antibody secreted by the hybridoma cell line described above. A fourth object of the invention is to provide the use of a monoclonal antibody for detecting the 37 th component of a Tropical panonychus scale allergen. A fifth object of the present invention is to provide a test